PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00147.1.g00190.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 297aa    MW: 31324.6 Da    PI: 10.4144
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00147.1.g00190.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof92.72.9e-29184240460
                        zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                   + l+cprC s++tkfCy+nny++ qPr++C+aCrryWt+GGalr v   ++ r++ +
  Zjn_sc00147.1.g00190.1.am.mk 184 EPLPCPRCGSRETKFCYFNNYNVRQPRHLCRACRRYWTAGGALRRVTTASSGRRRLR 240
                                   5789******************************************98876665543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-21184229IPR003851Zinc finger, Dof-type
PfamPF027011.4E-26185238IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.499186240IPR003851Zinc finger, Dof-type
PROSITE patternPS013610188224IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MRVSIIFVLH LSSIRRKNEE GYLLVTLTEI VPVNKTLSPG TGSFVDSADP HKNLDQHKTS  60
RDQSIIIHDK AAPTKVKRLR DDHLHLLHSL FPRIKAAGVP NDASLLPFGS MDADAAGFKL  120
FGKVIQPPDA HQRAAEESVA TPPPPPPPPP ESMTPSQTLP TLPSSLPAAA AAAAAPSAAG  180
GTGEPLPCPR CGSRETKFCY FNNYNVRQPR HLCRACRRYW TAGGALRRVT TASSGRRRLR  240
SSAARSASAA AAAVAASASS ASAADERGAR ACVTQCRPIL PHASATGRSA CGPAEPS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032235e-63AP003223.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0007F06.
GenBankAP0032645e-63AP003264.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0485G01.
GenBankAP0149575e-63AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP147161620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.11e-22Dof family protein